Baimantuoluoside C

CAS No. 60124-17-6

Baimantuoluoside C ( )

Catalog No. M31673 CAS No. 60124-17-6

12-Deoxywithastramonolide is a natural product for research related to life sciences.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 202 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Baimantuoluoside C
  • Note
    Research use only, not for human use.
  • Brief Description
    12-Deoxywithastramonolide is a natural product for research related to life sciences.
  • Description
    12-Deoxywithastramonolide is a natural product for research related to life sciences.
  • Synonyms
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    60124-17-6
  • Formula Weight
    470.6
  • Molecular Formula
    C28H38O6
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • HCH6-1

    HCH6-1 is a competitive Formyl peptide receptor 1 (FPR1) antagonist.

  • Plathymenin

    Plathymenin is a natural product isolated from Spatholobus suberectus.